Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO4 Peptide - middle region

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ23338, Imp4, MGC131665

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO4 Rabbit Polyclonal Antibody (orb331372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078934

Preservative

Lyophilized powder

AA Sequence

NLGPKVQPYLPELMECMLQLLRNPSSPRAKELAVSALGAIATAAQASLLP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vitamin D Binding Protein (DBP) ELISA Kit
MBS455977-01 48 Tests

Human Vitamin D Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin D Binding Protein (DBP) ELISA Kit
MBS455977-02 96 Tests

Human Vitamin D Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin D Binding Protein (DBP) ELISA Kit
MBS455977-03 5x 96 Tests

Human Vitamin D Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
Human Vitamin D Binding Protein (DBP) ELISA Kit
MBS455977-04 10x 96 Tests

Human Vitamin D Binding Protein (DBP) ELISA Kit

Sign In for Pricing
View Details
Mouse ARMCX5 shRNA Plasmid
abx984092-01 150 µg

Mouse ARMCX5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ARMCX5 shRNA Plasmid
abx984092-02 300 µg

Mouse ARMCX5 shRNA Plasmid

Sign In for Pricing
View Details