Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK8 Peptide - N-terminal region

CDK8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1560888

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK8 Rabbit Polyclonal Antibody (orb324364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102531

Preservative

Lyophilized powder

AA Sequence

MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPID, C-His Tag
HA210669-01 20 µg

Human PPID, C-His Tag

Sign In for Pricing
View Details
Human PPID, C-His Tag
HA210669-02 50 µg

Human PPID, C-His Tag

Sign In for Pricing
View Details
Human PPID, C-His Tag
HA210669-03 100 µg

Human PPID, C-His Tag

Sign In for Pricing
View Details
Recombinant Human Pancreasin/Marapsin/PRSS27 Protein (His Tag)
PKSH030900 50 µg

Recombinant Human Pancreasin/Marapsin/PRSS27 Protein (His Tag)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details