CDK8 Peptide - N-terminal region
CDK8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RGD1560888
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDK8 Rabbit Polyclonal Antibody (orb324364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001102531
Preservative
Lyophilized powder
AA Sequence
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041154-500 1x 500 µL
Mucin 3 (MUC3/1154), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1474-100 1x 100 µL
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041646-100 1x 100 µL
CD99 / MIC2 (Ewing's Sarcoma Marker), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040096-500 1x 500 µL
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040911-100 1x 100 µL
PTH / Parathyroid Hormone (N-Terminal) (PTH/911), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details