Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdcd2 Peptide - middle region

Pdcd2 Peptide - middle region

Product Specifications

UniProt

P47816

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pdcd2 Rabbit Polyclonal Antibody (orb329578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113826

Preservative

Lyophilized powder

AA Sequence

AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdha11 ORF Vector (Rat) (pORF)
ORF073163 1.0 µg DNA

Pcdha11 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human C19orf80 protein
orb244864-01 20 µg

Human C19orf80 protein

Sign In for Pricing
View Details
Human C19orf80 protein
orb244864-02 100 µg

Human C19orf80 protein

Sign In for Pricing
View Details
Human C19orf80 protein
orb244864-03 1 mg

Human C19orf80 protein

Sign In for Pricing
View Details
ET-2 Rabbit Polyclonal Antibody
orb1741993 100 µL

ET-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lysol (Cresol and soap Solution) (Disinfectant)
01577 00500 500 mL

Lysol (Cresol and soap Solution) (Disinfectant)

Sign In for Pricing
View Details