Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdcd2 Peptide - middle region

Pdcd2 Peptide - middle region

Product Specifications

UniProt

P47816

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pdcd2 Rabbit Polyclonal Antibody (orb329578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113826

Preservative

Lyophilized powder

AA Sequence

AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGED4 discontinued
511301 100 µg

MAGED4 discontinued

Sign In for Pricing
View Details
UBE2B (HR6B, UBC2, HHR6B, RAD6B, E2-17kD, Ubiquitin-conjugating Enzyme E2 B) (HRP).
MBS6450148-01 0.1 mL

UBE2B (HR6B, UBC2, HHR6B, RAD6B, E2-17kD, Ubiquitin-conjugating Enzyme E2 B) (HRP).

Sign In for Pricing
View Details
UBE2B (HR6B, UBC2, HHR6B, RAD6B, E2-17kD, Ubiquitin-conjugating Enzyme E2 B) (HRP).
MBS6450148-02 5x 0.1 mL

UBE2B (HR6B, UBC2, HHR6B, RAD6B, E2-17kD, Ubiquitin-conjugating Enzyme E2 B) (HRP).

Sign In for Pricing
View Details
Lyn Antibody (YA3693, Mouse)
HY-P83996-01 10 µL

Lyn Antibody (YA3693, Mouse)

Sign In for Pricing
View Details
Lyn Antibody (YA3693, Mouse)
HY-P83996-02 50 μL

Lyn Antibody (YA3693, Mouse)

Sign In for Pricing
View Details
Lyn Antibody (YA3693, Mouse)
HY-P83996-03 100 µL

Lyn Antibody (YA3693, Mouse)

Sign In for Pricing
View Details