Cacnb2 Peptide - middle region
Cacnb2 Peptide - middle region
Product Specifications
Product Name Alternative
Cacnlb2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cacnb2 Rabbit Polyclonal Antibody (orb575549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_446303
Preservative
Lyophilized powder
AA Sequence
DFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P4332-01D-Biotin 100 µL
Pneumocystis jiroveci (Pneumocystis carinii) (Biotin) discontinued
Sign In for Pricing
View Details 
MBS2165132-01 0.1 mL
APC-Linked Monoclonal Antibody to Axis Inhibition Protein 2 (AXIN2)
Sign In for Pricing
View Details MBS2165132-02 0.2 mL
APC-Linked Monoclonal Antibody to Axis Inhibition Protein 2 (AXIN2)
Sign In for Pricing
View Details