Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxk1 Peptide - N-terminal region

Foxk1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1309643

UniProt

D3ZU55

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxk1 Rabbit Polyclonal Antibody (orb576701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032296

Preservative

Lyophilized powder

AA Sequence

PVPSTAATATATAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF19B (NM_001300826) Human Untagged Clone
SC337330 10 µg

RNF19B (NM_001300826) Human Untagged Clone

Sign In for Pricing
View Details
SEC24C (NM_198597) Human Recombinant Protein
PH32646I5 20 µg

SEC24C (NM_198597) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
SIPD845Hu01-01 10 µg

Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details
Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
SIPD845Hu01-02 50 µg

Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details
Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
SIPD845Hu01-03 200 µg

Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details
Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)
SIPD845Hu01-04 1 mg

Recombinant Acyl Coenzyme A Oxidase 2, Branched (ACOX2)

Sign In for Pricing
View Details