Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Racgap1 Peptide - C-terminal region

Racgap1 Peptide - C-terminal region

Product Specifications

UniProt

B2GV02

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Racgap1 Rabbit Polyclonal Antibody (orb576936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101582

Preservative

Lyophilized powder

AA Sequence

GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), Biotin conjugate, 0.1mg/mL
BNCB0252-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
POMZP3 (NM_012230) Human Over-expression Lysate
LY402170 100 µg

POMZP3 (NM_012230) Human Over-expression Lysate

Sign In for Pricing
View Details
TSPAN4 Human Gene Knockout Kit (CRISPR)
KN401355 1 Kit

TSPAN4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI6F10]
CF804294 100 µg

SP17 (SPA17) Mouse Monoclonal Antibody [Clone ID: OTI6F10]

Sign In for Pricing
View Details
Mouse PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-M0634-01 24 Tests

Mouse PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details
Mouse PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit
E-EL-M0634-02 48 Tests

Mouse PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) ELISA Kit

Sign In for Pricing
View Details