Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Racgap1 Peptide - C-terminal region

Racgap1 Peptide - C-terminal region

Product Specifications

UniProt

B2GV02

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Racgap1 Rabbit Polyclonal Antibody (orb576936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101582

Preservative

Lyophilized powder

AA Sequence

GPVTTPEFQLVKTPSSNSLSQRLYNLSKSTPRFGNKSKSATNLGQQGKFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-R0093-01 5x 96 Tests

Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit
E-UNEL-R0093-02 15x 96 Tests

Uncoated Rat MCSF (Macrophage Colony Stimulating Factor 1) ELISA Kit

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A9]
TA804680AM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A9]

Sign In for Pricing
View Details
5M Sodium Chloride, Biotechnology Grade, 500ml
PB0570-500ml 500 mL

5M Sodium Chloride, Biotechnology Grade, 500ml

Sign In for Pricing
View Details
TNF alpha (TNF) (NM_000594) Human Recombinant Protein
TP750117 50 µg

TNF alpha (TNF) (NM_000594) Human Recombinant Protein

Sign In for Pricing
View Details
5Alpha-Cholestane-2,2,3,3,4,4-d6
TRC-C431703-1MG 1 mg

5Alpha-Cholestane-2,2,3,3,4,4-d6

Sign In for Pricing
View Details