Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubtf Peptide - N-terminal region

Ubtf Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfubf

UniProt

P25977

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubtf Rabbit Polyclonal Antibody (orb576947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099193

Preservative

Lyophilized powder

AA Sequence

TDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit
MBS8819715-01 48 Strip Well

Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit

Sign In for Pricing
View Details
Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit
MBS8819715-02 96 Strip Well

Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit

Sign In for Pricing
View Details
Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit
MBS8819715-03 5x 96 Strip Well

Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit

Sign In for Pricing
View Details
Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit
MBS8819715-04 10x 96 Strip Well

Mouse STAT6 (Signal Transducer And Activator Of Transcription 6) ELISA Kit

Sign In for Pricing
View Details
Methyl[ (1-methyl-1H-imidazol-4-yl) methyl]amine
ITB24652-01 50 mg

Methyl[ (1-methyl-1H-imidazol-4-yl) methyl]amine

Sign In for Pricing
View Details
Methyl[ (1-methyl-1H-imidazol-4-yl) methyl]amine
ITB24652-02 0.5 g

Methyl[ (1-methyl-1H-imidazol-4-yl) methyl]amine

Sign In for Pricing
View Details