Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubtf Peptide - N-terminal region

Ubtf Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfubf

UniProt

P25977

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubtf Rabbit Polyclonal Antibody (orb576947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099193

Preservative

Lyophilized powder

AA Sequence

TDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU7-59P sgRNA CRISPR Lentivector (Human) (Target 1)
K1860402 1.0 µg DNA

RNU7-59P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
LOC63929 (X-prolyl Aminopeptidase (Aminopeptidase P) 3, Putative, APP3)
588528 50 µg

LOC63929 (X-prolyl Aminopeptidase (Aminopeptidase P) 3, Putative, APP3)

Sign In for Pricing
View Details
4-Chloro-L-phenylalanine, N-BOC protected
OR14548-01 5 g

4-Chloro-L-phenylalanine, N-BOC protected

Sign In for Pricing
View Details
4-Chloro-L-phenylalanine, N-BOC protected
OR14548-02 25 g

4-Chloro-L-phenylalanine, N-BOC protected

Sign In for Pricing
View Details
4-Chloro-L-phenylalanine, N-BOC protected
OR14548-03 500 g

4-Chloro-L-phenylalanine, N-BOC protected

Sign In for Pricing
View Details
MYBPC1 (Myosin-binding Protein C, Slow-type, Slow MyBP-C, C-protein, Skeletal Muscle Slow Isoform, MYBPCS) (MaxLight 650)
130039-ML650 100 µL

MYBPC1 (Myosin-binding Protein C, Slow-type, Slow MyBP-C, C-protein, Skeletal Muscle Slow Isoform, MYBPCS) (MaxLight 650)

Sign In for Pricing
View Details