Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx1 Peptide - C-terminal region

Prrx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Pmx1, Prx-1

UniProt

P63014

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrx1 Rabbit Polyclonal Antibody (orb330065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722543

Preservative

Lyophilized powder

AA Sequence

ASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA2 Rabbit pAb, Cy5.5 conjugated
orb3000828 100 µL

BRCA2 Rabbit pAb, Cy5.5 conjugated

Sign In for Pricing
View Details
Guinea pig C3 (Complement Component 3) ELISA Kit
EK250554 96 Well

Guinea pig C3 (Complement Component 3) ELISA Kit

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2141548-01 0.1 mL

HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2141548-02 0.2 mL

HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2141548-03 0.5 mL

HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2141548-04 1 mL

HRP-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Sign In for Pricing
View Details