Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx1 Peptide - C-terminal region

Prrx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Pmx1, Prx-1

UniProt

P63014

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrx1 Rabbit Polyclonal Antibody (orb330065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722543

Preservative

Lyophilized powder

AA Sequence

ASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo11 3'UTR Lenti-reporter-Luc Vector
20309086 1.0 µg

Fbxo11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
1-Bromopentane-4,4,5,5,5-d5
B686252 10 mg

1-Bromopentane-4,4,5,5,5-d5

Sign In for Pricing
View Details
COX4I1 Rabbit Polyclonal Antibody (PE)
orb499366 100 µL

COX4I1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Cog7 Mouse shRNA Plasmid (Locus ID 233824)
TL507048 1 Kit

Cog7 Mouse shRNA Plasmid (Locus ID 233824)

Sign In for Pricing
View Details
Lentiviral human ARL4A shRNA (UAS) - Lentiviral human ARL4A shRNA (UAS) (25)
GTR15104537 1 Vial

Lentiviral human ARL4A shRNA (UAS) - Lentiviral human ARL4A shRNA (UAS) (25)

Sign In for Pricing
View Details
Aloin B
MA76227-01 50 mg

Aloin B

Sign In for Pricing
View Details