Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdx1 Peptide - middle region

Pdx1 Peptide - middle region

Product Specifications

Product Name Alternative

Idx1, Ipf1|Stf1

UniProt

A2ASN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_074043

Preservative

Lyophilized powder

AA Sequence

ISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam46b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3254502 1.0 µg DNA

Fam46b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Uncharacterized protein C18orf23 (C18orf23) Human ELISA Kit
I0874 96 Tests

Uncharacterized protein C18orf23 (C18orf23) Human ELISA Kit

Sign In for Pricing
View Details
FGTI-2734 25mg
A18578-25 25 mg

FGTI-2734 25mg

Sign In for Pricing
View Details
IKZF3 Mouse Monoclonal Capture Antibody [Clone ID: OTI5E2]
TA600526 100 µg

IKZF3 Mouse Monoclonal Capture Antibody [Clone ID: OTI5E2]

Sign In for Pricing
View Details
PRSS51 shRNA (m) Lentiviral Particles
sc-108290-V 200 µL

PRSS51 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Fam190a ORF Vector (Mouse) (pORF)
ORF044421 1.0 µg DNA

Fam190a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details