Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1311188 Peptide - middle region

RGD1311188 Peptide - middle region

Product Specifications

UniProt

B1WC62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGD1311188 Rabbit Polyclonal Antibody (orb324809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129369

Preservative

Lyophilized powder

AA Sequence

REEWECLSFSQRTLYRDVMLENFRNLNELGCCGRKPSLISRLEQWDEPWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-500 1x 500 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL
BNC940521-100 1x 100 µL

AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (CD68/G2), CF405S conjugate, 0.1mg/mL
BNC040919-500 1x 500 µL

CD68 (CD68/G2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details