Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmbx1 Peptide - C-terminal region

Dmbx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Atx, Cdmx, Mbx, Otx3

UniProt

Q91ZK4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmbx1 Rabbit Polyclonal Antibody (orb324822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570935

Preservative

Lyophilized powder

AA Sequence

SLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNSKTTSIENLRLRAKQHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCAR1 Polyclonal Antibody
RA32606-01 50 µL

HCAR1 Polyclonal Antibody

Sign In for Pricing
View Details
HCAR1 Polyclonal Antibody
RA32606-02 100 µL

HCAR1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Prohibitin 2 (PHB2)
MBS2123728-01 0.01 mg

Recombinant Prohibitin 2 (PHB2)

Sign In for Pricing
View Details
Recombinant Prohibitin 2 (PHB2)
MBS2123728-02 0.05 mg

Recombinant Prohibitin 2 (PHB2)

Sign In for Pricing
View Details
Recombinant Prohibitin 2 (PHB2)
MBS2123728-03 0.1 mg

Recombinant Prohibitin 2 (PHB2)

Sign In for Pricing
View Details
Recombinant Prohibitin 2 (PHB2)
MBS2123728-04 0.2 mg

Recombinant Prohibitin 2 (PHB2)

Sign In for Pricing
View Details