Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmbx1 Peptide - C-terminal region

Dmbx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Atx, Cdmx, Mbx, Otx3

UniProt

Q91ZK4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmbx1 Rabbit Polyclonal Antibody (orb324822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570935

Preservative

Lyophilized powder

AA Sequence

SLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNSKTTSIENLRLRAKQHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human APC membrane recruitment protein 3 (FAM123C) , partial
MBS1462532 Inquire

Recombinant Human APC membrane recruitment protein 3 (FAM123C) , partial

Sign In for Pricing
View Details
WD Repeat Domain Phosphoinositide-Interacting Protein 2 (WIPI2) Antibody (ALP)
abx447410 100 µg

WD Repeat Domain Phosphoinositide-Interacting Protein 2 (WIPI2) Antibody (ALP)

Sign In for Pricing
View Details
Rabbit Polyclonal DNAL1 Antibody [mFluor Violet 450 SE]
NBP1-76932MFV450 0.1 mL

Rabbit Polyclonal DNAL1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Lentiviral mouse Atf6 shRNA (UAS) - Lentiviral mouse Atf6 shRNA (UAS, RFP) (100)
GTR15220476 1 Vial

Lentiviral mouse Atf6 shRNA (UAS) - Lentiviral mouse Atf6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TMED10 Antibody (C-term)
orb1932470-01 50 µL

TMED10 Antibody (C-term)

Sign In for Pricing
View Details
TMED10 Antibody (C-term)
orb1932470-02 100 µL

TMED10 Antibody (C-term)

Sign In for Pricing
View Details