Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp74 Peptide - C-terminal region

Zfp74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810054M15Rik, KRAB8, Zfp66, Znf569, mszf21, mszf77

UniProt

Q80W31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp74 Rabbit Polyclonal Antibody (orb324824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848471

Preservative

Lyophilized powder

AA Sequence

SNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI6A2]
CF813780 100 µg

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI6A2]

Sign In for Pricing
View Details
Polystyrene AM COOH
H12516003.25G 25 g

Polystyrene AM COOH

Sign In for Pricing
View Details
Human Transcobalamin I (TCN1) ELISA Kit
RD-TCN1-Hu-01 96 Tests

Human Transcobalamin I (TCN1) ELISA Kit

Sign In for Pricing
View Details
Human Transcobalamin I (TCN1) ELISA Kit
RD-TCN1-Hu-02 48 Tests

Human Transcobalamin I (TCN1) ELISA Kit

Sign In for Pricing
View Details
PLEKHO2 Antibody
KC-28968-01 50 μL

PLEKHO2 Antibody

Sign In for Pricing
View Details
PLEKHO2 Antibody
KC-28968-02 100 µL

PLEKHO2 Antibody

Sign In for Pricing
View Details