Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp74 Peptide - C-terminal region

Zfp74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810054M15Rik, KRAB8, Zfp66, Znf569, mszf21, mszf77

UniProt

Q80W31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp74 Rabbit Polyclonal Antibody (orb324824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848471

Preservative

Lyophilized powder

AA Sequence

SNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2,4-Triaminobenzene Dihydrochloride
TRC-T895865-500MG 500 mg

1,2,4-Triaminobenzene Dihydrochloride

Sign In for Pricing
View Details
General Receptor for phosphoinositides 1 (GRASP) Rabbit Polyclonal Antibody
TA372613 100 µL

General Receptor for phosphoinositides 1 (GRASP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human B3GNT9 activation kit by CRISPRa
GA113684 1 Kit

Human B3GNT9 activation kit by CRISPRa

Sign In for Pricing
View Details
Xylazine-KLH Conjugate
50621-AAT 1 mg

Xylazine-KLH Conjugate

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS808118 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
RPS17L (NM_001199057) Human Over-expression Lysate
LC433763 20 µg

RPS17L (NM_001199057) Human Over-expression Lysate

Sign In for Pricing
View Details