Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gapdh Peptide - C-terminal region

Gapdh Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gapd, MGC102544, MGC102546, MGC103190, MGC103191, MGC105239

UniProt

P16858

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gapdh Rabbit Polyclonal Antibody (orb577474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032110

Preservative

Lyophilized powder

AA Sequence

FNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB4 Rabbit Polyclonal Antibody
TA365997 100 µL

HLA-DRB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIMM8A Rabbit Polyclonal Antibody
TA365918 100 µL

TIMM8A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SUCNR1 Antibody
8G748-AAT 50 µg

SUCNR1 Antibody

Sign In for Pricing
View Details
SATB1 Recombinant Rabbit Monoclonal Antibody [SP05-03]
ET1604-10 100 µL

SATB1 Recombinant Rabbit Monoclonal Antibody [SP05-03]

Sign In for Pricing
View Details
Actb Mouse Gene Knockout Kit (CRISPR)
KN500772 1 Kit

Actb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant EpCAM Antibody
RC-5049-01 50 μL

Recombinant EpCAM Antibody

Sign In for Pricing
View Details