Gapdh Peptide - C-terminal region
Gapdh Peptide - C-terminal region
Product Specifications
Product Name Alternative
Gapd, MGC102544, MGC102546, MGC103190, MGC103191, MGC105239
UniProt
P16858
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gapdh Rabbit Polyclonal Antibody (orb577474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032110
Preservative
Lyophilized powder
AA Sequence
FNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSR030342 100 µg
Recombinant Rat BAFFR/TNFRSF13C Protein (His Tag)
Sign In for Pricing
View Details 
AP51093PU-N 400 µL
Beta crystallin S (CRYGS) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
PKSM040886 100 µg
Recombinant Mouse L-Selectin/SELL Protein (His & Fc Tag)
Sign In for Pricing
View Details 
