Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTCA Peptide - middle region

RTCA Peptide - middle region

Product Specifications

Product Name Alternative

Rtcd1

UniProt

Q68FS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RTCA Rabbit Polyclonal Antibody (orb577614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004227

Preservative

Lyophilized powder

AA Sequence

QHLSGLEMVRDLCDGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pla2g4b ORF Vector (Rat) (pORF)
ORF073589 1.0 µg DNA

Pla2g4b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
LSR Polyclonal Antibody
orb618594-01 50 μL

LSR Polyclonal Antibody

Sign In for Pricing
View Details
LSR Polyclonal Antibody
orb618594-02 100 µL

LSR Polyclonal Antibody

Sign In for Pricing
View Details
EIF4G Rabbit mAb
C05299-20ul 20 µL

EIF4G Rabbit mAb

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)
MBS2148802-01 0.1 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)
MBS2148802-02 0.2 mL

PE-Linked Monoclonal Antibody to Transforming Growth Factor Alpha (TGFa)

Sign In for Pricing
View Details