Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl24 Peptide - C-terminal region

Mrpl24 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC94307

UniProt

Q66H47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl24 Rabbit Polyclonal Antibody (orb577866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007638

Preservative

Lyophilized powder

AA Sequence

GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBCO-PEG4-ATTO-488
CLK-052-05 0.5 mg

DBCO-PEG4-ATTO-488

Sign In for Pricing
View Details
Anti-c-Jun (phospho-Y170) Antibody
A02038Y170 100 µL

Anti-c-Jun (phospho-Y170) Antibody

Sign In for Pricing
View Details
RGD1312005 Protein Vector (Rat) (pPM-C-His)
PV300061 500 ng

RGD1312005 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human NUDT22 shRNA (UAS) - Lentiviral human NUDT22 shRNA (UAS, iRFP) (100)
GTR15096843 1 Vial

Lentiviral human NUDT22 shRNA (UAS) - Lentiviral human NUDT22 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RBM27 siRNA (Mouse)
MBS828288-01 15 nmol

RBM27 siRNA (Mouse)

Sign In for Pricing
View Details
RBM27 siRNA (Mouse)
MBS828288-02 30 nmol

RBM27 siRNA (Mouse)

Sign In for Pricing
View Details