Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl24 Peptide - C-terminal region

Mrpl24 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC94307

UniProt

Q66H47

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl24 Rabbit Polyclonal Antibody (orb577866) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007638

Preservative

Lyophilized powder

AA Sequence

GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED6 Mouse Monoclonal Antibody [Clone ID: OTI3B9]
CF808213 100 µg

MED6 Mouse Monoclonal Antibody [Clone ID: OTI3B9]

Sign In for Pricing
View Details
Human ZNF624 activation kit by CRISPRa
GA111579 1 Kit

Human ZNF624 activation kit by CRISPRa

Sign In for Pricing
View Details
Human HGF Recombinant Rabbit Monoclonal Antibody [PSH03-78] - BSA and Azide free (Capture)
HA722042 100 µL

Human HGF Recombinant Rabbit Monoclonal Antibody [PSH03-78] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
2,2,2-Trifluoro-N-phenylacetimidoyl Chloride
TRC-T792605-1G 1 g

2,2,2-Trifluoro-N-phenylacetimidoyl Chloride

Sign In for Pricing
View Details
Human RPL34 activation kit by CRISPRa
GA104174 1 Kit

Human RPL34 activation kit by CRISPRa

Sign In for Pricing
View Details
Prothoate
TRC-P838810-1G 1 g

Prothoate

Sign In for Pricing
View Details