Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnd1 Peptide - middle region

Dnd1 Peptide - middle region

Product Specifications

UniProt

D3ZQ06

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnd1 Rabbit Polyclonal Antibody (orb577950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102849

Preservative

Lyophilized powder

AA Sequence

KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SATB2 Antibody
V4935-100UG 100 µg

SATB2 Antibody

Sign In for Pricing
View Details
ODQ
2051-10 10 mg

ODQ

Sign In for Pricing
View Details
NUCKS1 Rabbit pAb
MBS9145025-01 0.02 mL

NUCKS1 Rabbit pAb

Sign In for Pricing
View Details
NUCKS1 Rabbit pAb
MBS9145025-02 0.1 mL

NUCKS1 Rabbit pAb

Sign In for Pricing
View Details
NUCKS1 Rabbit pAb
MBS9145025-03 5x 0.1 mL

NUCKS1 Rabbit pAb

Sign In for Pricing
View Details
RUNX1 Recombinant Protein (Mouse)
RP169661 100 µg

RUNX1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details