Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnd1 Peptide - middle region

Dnd1 Peptide - middle region

Product Specifications

UniProt

D3ZQ06

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnd1 Rabbit Polyclonal Antibody (orb577950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102849

Preservative

Lyophilized powder

AA Sequence

KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTG2 (Protein BTG2, BTG Family Member 2, PC3, NGF-inducible Anti-proliferative Protein PC3, MGC126063, MGC126064, TIS21) (MaxLight 750) discontinued
124041-ML750 100 µL

BTG2 (Protein BTG2, BTG Family Member 2, PC3, NGF-inducible Anti-proliferative Protein PC3, MGC126063, MGC126064, TIS21) (MaxLight 750) discontinued

Sign In for Pricing
View Details
HMPH Recombinant Rabbit Monoclonal Antibody
orb2562091-01 25 µL

HMPH Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HMPH Recombinant Rabbit Monoclonal Antibody
orb2562091-02 50 µL

HMPH Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HMPH Recombinant Rabbit Monoclonal Antibody
orb2562091-03 100 µL

HMPH Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GABRG3 Human Over-expression Lysate
orb1356156 100 µg

GABRG3 Human Over-expression Lysate

Sign In for Pricing
View Details
LRRC20 Antibody (HRP)
orb34997-01 50 µg

LRRC20 Antibody (HRP)

Sign In for Pricing
View Details