Vtn Peptide - middle region
Vtn Peptide - middle region
Product Specifications
Product Name Alternative
Aa1018, MGC124961|Vn
UniProt
Q3KR94
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Vtn Rabbit Polyclonal Antibody (orb578048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062029
Preservative
Lyophilized powder
AA Sequence
EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15386395 1 Vial
Lentiviral human RASD2 sgRNA gene knockout kit - Lentiviral human RASD2 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 127776-AP 100 µL
HDAC9 (Histone Deacetylase 9, HD9, Histone Deacetylase 7B, HD7, HD7b, Histone Deacetylase-related Protein, MEF2-interacting Transcription Repressor MITR, HDAC7, HDAC7B, HDRP, KIAA0744, MITR) (AP) discontinued
Sign In for Pricing
View Details MBS201411-01 0.01 mg
Recombinant human Fc gamma RIIIA/CD16a protein
Sign In for Pricing
View Details