Vtn Peptide - middle region
Vtn Peptide - middle region
Product Specifications
Product Name Alternative
Aa1018, MGC124961|Vn
UniProt
Q3KR94
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Vtn Rabbit Polyclonal Antibody (orb578048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062029
Preservative
Lyophilized powder
AA Sequence
EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS641800-01 0.2 mL
HIST1H2AL, CT (HIST1H2AG, H2AFP, Histone H2A type 1, Histone H2A/p)
Sign In for Pricing
View Details MBS641800-02 5x 0.2 mL
HIST1H2AL, CT (HIST1H2AG, H2AFP, Histone H2A type 1, Histone H2A/p)
Sign In for Pricing
View Details 
MBS687187-01 0.5 mg
Goat anti-Human IgA (alpha chain) - Affinity Pure, ALP Conjugate, min x w/bovine, mouse, and rabbit serum proteins
Sign In for Pricing
View Details