Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urod Peptide - N-terminal region

Urod Peptide - N-terminal region

Product Specifications

Product Name Alternative

Porphyrinogen carboxy-lyase

UniProt

B0BN55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Urod Rabbit Polyclonal Antibody (orb578183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062082

Preservative

Lyophilized powder

AA Sequence

AAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTL9 Human qPCR Primer Pair (NM_178525)
HP218853 200 Reactions

ACTL9 Human qPCR Primer Pair (NM_178525)

Sign In for Pricing
View Details
GMPPB Rabbit Polyclonal Antibody
TA376625 100 µL

GMPPB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPM1G Mouse Monoclonal Antibody [Clone ID: k1G6]
AM09028PU-N 100 µL

PPM1G Mouse Monoclonal Antibody [Clone ID: k1G6]

Sign In for Pricing
View Details
Pirlimycin Hydrochloride
TRC-P509305-1MG 1 mg

Pirlimycin Hydrochloride

Sign In for Pricing
View Details
GLUR3 (GRIA3) Human Gene Knockout Kit (CRISPR)
KN419063 1 Kit

GLUR3 (GRIA3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD300LB Antibody (Biotin)
KB-28085-01 50 μL

CD300LB Antibody (Biotin)

Sign In for Pricing
View Details