Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urod Peptide - N-terminal region

Urod Peptide - N-terminal region

Product Specifications

Product Name Alternative

Porphyrinogen carboxy-lyase

UniProt

B0BN55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Urod Rabbit Polyclonal Antibody (orb578183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062082

Preservative

Lyophilized powder

AA Sequence

AAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM3 Antibody
KC-26898-01 50 μL

CADM3 Antibody

Sign In for Pricing
View Details
CADM3 Antibody
KC-26898-02 100 µL

CADM3 Antibody

Sign In for Pricing
View Details
CADM3 Antibody
KC-26898-03 1 mL

CADM3 Antibody

Sign In for Pricing
View Details
SOX10 (SOX10/991), 0.2mg/mL
BNUB0991-100 1x 100 µL

SOX10 (SOX10/991), 0.2mg/mL

Sign In for Pricing
View Details
STX2 Antibody (Biotin)
KB-19034-01 50 μL

STX2 Antibody (Biotin)

Sign In for Pricing
View Details
STX2 Antibody (Biotin)
KB-19034-02 100 µL

STX2 Antibody (Biotin)

Sign In for Pricing
View Details