Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grem1 Peptide - C-terminal region

Grem1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cktsf1b1, Drm, ld

UniProt

O70326

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grem1 Rabbit Polyclonal Antibody (orb333715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035954

Preservative

Lyophilized powder

AA Sequence

EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCG5 Polyclonal Antibody
E-AB-68000-01 60 µL

ABCG5 Polyclonal Antibody

Sign In for Pricing
View Details
ABCG5 Polyclonal Antibody
E-AB-68000-02 120 µL

ABCG5 Polyclonal Antibody

Sign In for Pricing
View Details
ABCG5 Polyclonal Antibody
E-AB-68000-03 200 µL

ABCG5 Polyclonal Antibody

Sign In for Pricing
View Details
ATF3 Recombinant Rabbit monoclonal Antibody
HA723964 100 µL

ATF3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Spin2-ps1 Mouse Gene Knockout Kit (CRISPR)
KN516608 1 Kit

Spin2-ps1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details