Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grem1 Peptide - C-terminal region

Grem1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cktsf1b1, Drm, ld

UniProt

O70326

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grem1 Rabbit Polyclonal Antibody (orb333715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035954

Preservative

Lyophilized powder

AA Sequence

EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRE11 Polyclonal Antibody
E-AB-15211-01 20 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
E-AB-15211-02 60 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
E-AB-15211-03 120 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
E-AB-15211-04 200 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
3-Bromophthalic Anhydride
TRC-B688068-5G 5 g

3-Bromophthalic Anhydride

Sign In for Pricing
View Details
THNSL2 (NM_018271) Human Recombinant Protein
TP309049L 1 mg

THNSL2 (NM_018271) Human Recombinant Protein

Sign In for Pricing
View Details