Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ogn Peptide - C-terminal region

Ogn Peptide - C-terminal region

Product Specifications

UniProt

D3ZVB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ogn Rabbit Polyclonal Antibody (orb578457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099573

Preservative

Lyophilized powder

AA Sequence

LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DET1 Human Gene Knockout Kit (CRISPR)
KN416467 1 Kit

DET1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD82 (N-Fc)
PKSH033916-01 10 µg

Recombinant Human CD82 (N-Fc)

Sign In for Pricing
View Details
Recombinant Human CD82 (N-Fc)
PKSH033916-02 50 µg

Recombinant Human CD82 (N-Fc)

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
CP565748 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-01 24 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-02 48 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details