Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ogn Peptide - C-terminal region

Ogn Peptide - C-terminal region

Product Specifications

UniProt

D3ZVB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ogn Rabbit Polyclonal Antibody (orb578457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099573

Preservative

Lyophilized powder

AA Sequence

LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AASS Antibody
8C14422-AAT 50 µg

AASS Antibody

Sign In for Pricing
View Details
ITM2C (NM_030926) Human Over-expression Lysate
LY403097 100 µg

ITM2C (NM_030926) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559291 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
Recombinant Human KLRD1/CD94 Protein (His Tag)
PKSH032785-01 10 µg

Recombinant Human KLRD1/CD94 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human KLRD1/CD94 Protein (His Tag)
PKSH032785-02 50 µg

Recombinant Human KLRD1/CD94 Protein (His Tag)

Sign In for Pricing
View Details
(2Z)-1-Chloro-2-decene
TRC-C377930-2.5MG 2.5 mg

(2Z)-1-Chloro-2-decene

Sign In for Pricing
View Details