Ankrd13c Peptide - C-terminal region
Ankrd13c Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI505652, AU022220
UniProt
Q3UX43
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ankrd13c Rabbit Polyclonal Antibody (orb580393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013828
Preservative
Lyophilized powder
AA Sequence
EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7152520 Inquire
Rabbit anti-Human immunodeficiency virus type 2 subtype A (isolate D194)(HIV-2) TAT Polyclonal Antibody
Sign In for Pricing
View Details NBP1-71914JF549 0.1 mL
Rabbit Polyclonal CSDE1 Antibody [Janelia Fluor 549]
Sign In for Pricing
View Details 
LV674965 1.0 µg DNA
FMO4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details SP-85195-1 1 mg
SS-Endorphin, equine [Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 34241) ]
Sign In for Pricing
View Details