Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd13c Peptide - C-terminal region

Ankrd13c Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI505652, AU022220

UniProt

Q3UX43

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ankrd13c Rabbit Polyclonal Antibody (orb580393) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013828

Preservative

Lyophilized powder

AA Sequence

EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ginsenoside Rb2 25mg
A14523-25 25 mg

Ginsenoside Rb2 25mg

Sign In for Pricing
View Details
Rat Cluster of differentiation 63 (CD63) ELISA Kit
YP-W30066-01 48 Tests

Rat Cluster of differentiation 63 (CD63) ELISA Kit

Sign In for Pricing
View Details
Rat Cluster of differentiation 63 (CD63) ELISA Kit
YP-W30066-02 96 Tests

Rat Cluster of differentiation 63 (CD63) ELISA Kit

Sign In for Pricing
View Details
ABCB7 CRISPR Knock Out 293T Cell Line (Human)
11040141 1x 10^6 Cells / 1.0 mL

ABCB7 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rat KLRB1A shRNA Plasmid
abx990379-01 150 µg

Rat KLRB1A shRNA Plasmid

Sign In for Pricing
View Details
Rat KLRB1A shRNA Plasmid
abx990379-02 300 µg

Rat KLRB1A shRNA Plasmid

Sign In for Pricing
View Details