Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Setd5 Peptide - C-terminal region

Setd5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900045N06Rik, C330007C20, C85544, FLJ10707, MGC90828, mKIAA1757

UniProt

Q5XJV7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Setd5 Rabbit Polyclonal Antibody (orb580688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082661

Preservative

Lyophilized powder

AA Sequence

ESNITEKESDPADGEGPEPLSSALSKGATVYSPSRYSYQLLQCDSPRTES

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRAMEF19 knockdown cell line
ABC-KD12076 1 Vial

Human PRAMEF19 knockdown cell line

Sign In for Pricing
View Details
Mouse Monoclonal Vitamin D BP Antibody (VDBP/4481) [CoraFluor 1]
NBP3-14005CL1 0.1 mL

Mouse Monoclonal Vitamin D BP Antibody (VDBP/4481) [CoraFluor 1]

Sign In for Pricing
View Details
Phospho-RPA32/RPA2 (Thr21) Antibody
AF3183-01 100 µL

Phospho-RPA32/RPA2 (Thr21) Antibody

Sign In for Pricing
View Details
Phospho-RPA32/RPA2 (Thr21) Antibody
AF3183-02 200 µL

Phospho-RPA32/RPA2 (Thr21) Antibody

Sign In for Pricing
View Details
Hepatocyte Growth Factor (HGF) BioAssayTM ELISA Kit (Mouse)
025639 96 Tests

Hepatocyte Growth Factor (HGF) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Chlamydia trachomatis Antibody
MBS568367-01 1 mg

Chlamydia trachomatis Antibody

Sign In for Pricing
View Details