Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Setd5 Peptide - C-terminal region

Setd5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2900045N06Rik, C330007C20, C85544, FLJ10707, MGC90828, mKIAA1757

UniProt

Q5XJV7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Setd5 Rabbit Polyclonal Antibody (orb580688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082661

Preservative

Lyophilized powder

AA Sequence

ESNITEKESDPADGEGPEPLSSALSKGATVYSPSRYSYQLLQCDSPRTES

More Discoveries

Explore Other Products

Browse additional items from our catalog

REXO1 Antibody
MBS8583945-01 0.1 mL

REXO1 Antibody

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-02 0.1 mL (AF635)

REXO1 Antibody

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-03 0.1 mL (AF610)

REXO1 Antibody

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-04 0.1 mL (AF405S)

REXO1 Antibody

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-05 0.1 mL (AF405L)

REXO1 Antibody

Sign In for Pricing
View Details
REXO1 Antibody
MBS8583945-06 0.1 mL (AF546)

REXO1 Antibody

Sign In for Pricing
View Details