Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc90b Peptide - middle region

Ccdc90b Peptide - middle region

Product Specifications

Product Name Alternative

MGC114546, RGD1308637

UniProt

Q4V897

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc90b Rabbit Polyclonal Antibody (orb580814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020056

Preservative

Lyophilized powder

AA Sequence

VKQQLINETSRIRADNRLDINLERSRVTDMFTDQEKQLMEATNEFTKKDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mal-amino-sulfo
T39055 25 mg

Mal-amino-sulfo

Sign In for Pricing
View Details
FAM3B antibody
MBS9413831-01 0.05 mL

FAM3B antibody

Sign In for Pricing
View Details
FAM3B antibody
MBS9413831-02 0.1 mL

FAM3B antibody

Sign In for Pricing
View Details
FAM3B antibody
MBS9413831-03 5x 0.1 mL

FAM3B antibody

Sign In for Pricing
View Details
Recombinant Akkermansia muciniphila NADH-quinone oxidoreductase subunit B (nuoB)
MBS1033291-01 0.02 mg (E-Coli)

Recombinant Akkermansia muciniphila NADH-quinone oxidoreductase subunit B (nuoB)

Sign In for Pricing
View Details
Recombinant Akkermansia muciniphila NADH-quinone oxidoreductase subunit B (nuoB)
MBS1033291-02 0.1 mg (E-Coli)

Recombinant Akkermansia muciniphila NADH-quinone oxidoreductase subunit B (nuoB)

Sign In for Pricing
View Details