Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPAT3 Peptide - middle region

GPAT3 Peptide - middle region

Product Specifications

Product Name Alternative

Agpat9

UniProt

Q4V8J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPAT3 Rabbit Polyclonal Antibody (orb580979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020841

Preservative

Lyophilized powder

AA Sequence

HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EDNRA full length protein-synthetic nanodisc
MBS189985-01 0.01 mg

Human EDNRA full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human EDNRA full length protein-synthetic nanodisc
MBS189985-02 0.05 mg

Human EDNRA full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human EDNRA full length protein-synthetic nanodisc
MBS189985-03 0.1 mg

Human EDNRA full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human UGDH protein
orb1291944-01 50 µg

Human UGDH protein

Sign In for Pricing
View Details
Human UGDH protein
orb1291944-02 100 µg

Human UGDH protein

Sign In for Pricing
View Details
Human UGDH protein
orb1291944-03 200 µg

Human UGDH protein

Sign In for Pricing
View Details