Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPAT3 Peptide - middle region

GPAT3 Peptide - middle region

Product Specifications

Product Name Alternative

Agpat9

UniProt

Q4V8J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPAT3 Rabbit Polyclonal Antibody (orb580979) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020841

Preservative

Lyophilized powder

AA Sequence

HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bax inhibitor peptide V5
A4461-5.1 10 mM (in 1mL DMSO)

Bax inhibitor peptide V5

Sign In for Pricing
View Details
CPNE1 (NM_001198863) Human Tagged ORF Clone Lentiviral Particle
RC231303L3V 200 µL

CPNE1 (NM_001198863) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Periaxin Recombinant Protein Antigen
NBP1-89598PEP 0.1 mL

Periaxin Recombinant Protein Antigen

Sign In for Pricing
View Details
Caryophylli Flos Extract
E3159-25mg 25 mg

Caryophylli Flos Extract

Sign In for Pricing
View Details
Methyl Tert-Butyl Ether (MTBE) 99.8% GC
2905B 00500 500 mL

Methyl Tert-Butyl Ether (MTBE) 99.8% GC

Sign In for Pricing
View Details
Rat Macrophage Colony-Stimulating Factor, M-CSF ELISA Kit
MBS160111-01 48 Well

Rat Macrophage Colony-Stimulating Factor, M-CSF ELISA Kit

Sign In for Pricing
View Details