Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibcd1 Peptide - C-terminal region

Fibcd1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP23-65P13.6, AI448887

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fibcd1 Rabbit Polyclonal Antibody (orb580990) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAC39169

Preservative

Lyophilized powder

AA Sequence

DSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AccuGreenTM Standard 2, 100 ng/uL
#99838-T 1x 1 mL

AccuGreenTM Standard 2, 100 ng/uL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF740 conjugate, 0.1mg/mL
BNC741908-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLBD1 (NM_024829) Human Recombinant Protein
TP309501M 100 µg

PLBD1 (NM_024829) Human Recombinant Protein

Sign In for Pricing
View Details
RNF149 Mouse Monoclonal Antibody [Clone ID: OTI10B3]
CF810423 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI10B3]

Sign In for Pricing
View Details
Human TMEM220 activation kit by CRISPRa
GA117945 1 Kit

Human TMEM220 activation kit by CRISPRa

Sign In for Pricing
View Details
D-allo-Threonine
TRC-A548540-500MG 500 mg

D-allo-Threonine

Sign In for Pricing
View Details