Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibcd1 Peptide - C-terminal region

Fibcd1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP23-65P13.6, AI448887

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fibcd1 Rabbit Polyclonal Antibody (orb580990) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAC39169

Preservative

Lyophilized powder

AA Sequence

DSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Benzyl Hydantoin
TRC-B279000-500MG 500 mg

5-Benzyl Hydantoin

Sign In for Pricing
View Details
Bicyclo[3.2.1]octane-2,4-dione
TRC-B529020-500MG 500 mg

Bicyclo[3.2.1]octane-2,4-dione

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12H7]
TA502409AM 100 µL

beta Catenin (CTNNB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12H7]

Sign In for Pricing
View Details
HLA Class I Recombinant Mouse monoclonal Antibody
HA610264 100 µg

HLA Class I Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Vmn1r165 Mouse Gene Knockout Kit (CRISPR)
KN518955 1 Kit

Vmn1r165 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C1orf69 (IBA57) activation kit by CRISPRa
GA116341 1 Kit

Human C1orf69 (IBA57) activation kit by CRISPRa

Sign In for Pricing
View Details