Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amy1a Peptide - middle region

Amy1a Peptide - middle region

Product Specifications

Product Name Alternative

Amy1

UniProt

Q99N59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Amy1a Rabbit Polyclonal Antibody (orb582441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010970

Preservative

Lyophilized powder

AA Sequence

YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GAT1 Rabbit Polyclonal Antibody
HA500443 100 µL

B3GAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tgds Mouse Gene Knockout Kit (CRISPR)
KN517480 1 Kit

Tgds Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTERF3 Antibody
KC-36908-01 50 μL

MTERF3 Antibody

Sign In for Pricing
View Details
MTERF3 Antibody
KC-36908-02 100 µL

MTERF3 Antibody

Sign In for Pricing
View Details
MTERF3 Antibody
KC-36908-03 1 mL

MTERF3 Antibody

Sign In for Pricing
View Details
Human KCNH8 activation kit by CRISPRa
GA115136 1 Kit

Human KCNH8 activation kit by CRISPRa

Sign In for Pricing
View Details