Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amy1a Peptide - middle region

Amy1a Peptide - middle region

Product Specifications

Product Name Alternative

Amy1

UniProt

Q99N59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Amy1a Rabbit Polyclonal Antibody (orb582441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010970

Preservative

Lyophilized powder

AA Sequence

YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA4 Antibody
KC-8180-01 50 μL

CA4 Antibody

Sign In for Pricing
View Details
CA4 Antibody
KC-8180-02 100 µL

CA4 Antibody

Sign In for Pricing
View Details
CA4 Antibody
KC-8180-03 1 mL

CA4 Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Cytomegalovirus,  5nm
GM-604-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Cytomegalovirus, 5nm

Sign In for Pricing
View Details
CJC-1293 TFA Salt Hydrate (>90%)
TRC-C999008-5MG 5 mg

CJC-1293 TFA Salt Hydrate (>90%)

Sign In for Pricing
View Details
A-RAF (Ab-301/302) Antibody
8B0770-AAT 50 µg

A-RAF (Ab-301/302) Antibody

Sign In for Pricing
View Details