NLRX1 Peptide - C-terminal region
NLRX1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CLR11.3, DLNB26, FLJ21478, MGC131937, MGC21025, NOD26, NOD5, NOD9
UniProt
Q86UT6
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NLRX1 Rabbit Polyclonal Antibody (orb586184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_078894
Preservative
Lyophilized powder
AA Sequence
SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![IKB epsilon Recombinant Rabbit Monoclonal Antibody [JM62-63]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea826bc/imageurl/et1705-40.webp)
ET1705-40 100 µL
IKB epsilon Recombinant Rabbit Monoclonal Antibody [JM62-63]
Sign In for Pricing
View Details ![ICAM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]](https://cdn.genprice.uk/products/937/68dd1b72061270361ea19145/imageurl/ta507134am.webp)
TA507134AM 100 µL
ICAM3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]
Sign In for Pricing
View Details 
PKSH031010 100 µg
Recombinant Human STXBP1/UNC18A Protein (His & GST Tag)
Sign In for Pricing
View Details 