Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLRX1 Peptide - C-terminal region

NLRX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLR11.3, DLNB26, FLJ21478, MGC131937, MGC21025, NOD26, NOD5, NOD9

UniProt

Q86UT6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLRX1 Rabbit Polyclonal Antibody (orb586184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078894

Preservative

Lyophilized powder

AA Sequence

SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Rapid Luminometric ATP Assay Kit
21601-AAT 100 Tests

ReadiUse™ Rapid Luminometric ATP Assay Kit

Sign In for Pricing
View Details
5Beta/6Beta-Hydroxy Lurasidone Hydrochloride(Mixture of Diastereomers)
TRC-H943910-5MG 5 mg

5Beta/6Beta-Hydroxy Lurasidone Hydrochloride(Mixture of Diastereomers)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS807709 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
2-Hydroxybenzeneethanol
TRC-H828985-25G 25 g

2-Hydroxybenzeneethanol

Sign In for Pricing
View Details
Norgestrel
TRC-N689500-250MG 250 mg

Norgestrel

Sign In for Pricing
View Details
Rsph9 Mouse Gene Knockout Kit (CRISPR)
KN515168 1 Kit

Rsph9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details