Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA12A Peptide - N-terminal region

HSPA12A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ13874, KIAA0417

UniProt

O43301

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA12A Rabbit Polyclonal Antibody (orb586612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079291

Preservative

Lyophilized powder

AA Sequence

KALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQPAKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dopaquinone Impurity 3
RG-D151603-01 10 mg

Dopaquinone Impurity 3

Sign In for Pricing
View Details
Dopaquinone Impurity 3
RG-D151603-02 25 mg

Dopaquinone Impurity 3

Sign In for Pricing
View Details
Dopaquinone Impurity 3
RG-D151603-03 50 mg

Dopaquinone Impurity 3

Sign In for Pricing
View Details
Dopaquinone Impurity 3
RG-D151603-04 100 mg

Dopaquinone Impurity 3

Sign In for Pricing
View Details
MSK2 (phospho Thr568) Rabbit Polyclonal Antibody
APRab05044-01 20 µL

MSK2 (phospho Thr568) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MSK2 (phospho Thr568) Rabbit Polyclonal Antibody
APRab05044-02 50 µL

MSK2 (phospho Thr568) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details