Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA12A Peptide - N-terminal region

HSPA12A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ13874, KIAA0417

UniProt

O43301

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA12A Rabbit Polyclonal Antibody (orb586612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079291

Preservative

Lyophilized powder

AA Sequence

KALEIFAYALQYFKEQALKELSDQAGSEFENSDVRWVITVPAIWKQPAKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orciprenaline Sulfate
RM-O180300-01 10 mg

Orciprenaline Sulfate

Sign In for Pricing
View Details
Orciprenaline Sulfate
RM-O180300-02 25 mg

Orciprenaline Sulfate

Sign In for Pricing
View Details
Orciprenaline Sulfate
RM-O180300-03 50 mg

Orciprenaline Sulfate

Sign In for Pricing
View Details
Orciprenaline Sulfate
RM-O180300-04 100 mg

Orciprenaline Sulfate

Sign In for Pricing
View Details
5-Hydroxypentanoyl-CoA
HY-CE01500 1 Each

5-Hydroxypentanoyl-CoA

Sign In for Pricing
View Details
Recombinant Pelobacter carbinolicus Phosphopantetheine adenylyltransferase (coaD)
MBS1457713-01 0.02 mg (E-Coli)

Recombinant Pelobacter carbinolicus Phosphopantetheine adenylyltransferase (coaD)

Sign In for Pricing
View Details