Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGLYRP4 Peptide - N-terminal region

PGLYRP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PGLYRPIbeta, PGRP-Ibeta, PGRPIB, SBBI67

UniProt

Q96LB8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGLYRP4 Rabbit Polyclonal Antibody (orb586636) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065126

Preservative

Lyophilized powder

AA Sequence

LGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS800005 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
NFAT1 (NFATC2) (NM_001136021) Human Recombinant Protein
TP326803L 1 mg

NFAT1 (NFATC2) (NM_001136021) Human Recombinant Protein

Sign In for Pricing
View Details
Concanavalin A, CF®680 Conjugate
#29020 5x 1 mg

Concanavalin A, CF®680 Conjugate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD14 Antibody[Sa14-2]
E-AB-F1176UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
glnA Goat Polyclonal Antibody
TA396705S 25 µL

glnA Goat Polyclonal Antibody

Sign In for Pricing
View Details